Recombinant Human BRD7, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0348
Product Name:  Recombinant Human BRD7, GST-tagged
Product Overview:  Recombinant Human BRD7 full-length ORF (1 a.a. - 651 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description:  This gene encodes a protein which is a member of the bromodomain-containing protein family. The product of this gene has been identified as a component of one form of the SWI/SNF chromatin remodeling complex, and as a protein which interacts with p53 and is required for p53-dependent oncogene-induced senescence which prevents tumor growth. Pseudogenes have been described on chromosomes 2, 3, 6, 13 and 14. Alternative splicing results in multiple transcript variants.
Applications:  Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  97.13 kDa
Species:  Human
Formulation:  50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Tag:  GST
Amino Acid Sequence:  MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPG EEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEALNQLMRQLQRK DPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLL HSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKD MLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPIVGEPGYCPVRLGMTT GRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFANISKDDSDLIYSTYGEDSDLPSDFSIHEFLA TCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVT NFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQV TPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  BRD7 bromodomain containing 7 [ Homo sapiens ]
Gene ID NCBI:  29117
Synonyms:  BP75; NAG4; CELTIX1; bromodomain-containing protein 7; 75 kDa bromodomain protein; protein CELTIX-1
mRNA Refseq:  NM_001173984
Protein Refseq:  NP_001167455
Chromosome Location:  16q12
Function:  histone binding; lysine-acetylated histone binding; p53 binding

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.