Recombinant Human BRD2


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0321
Product Overview:  Recombinant fragment of Human BRD2 (amino acids 167-256) with N terminal proprietary tag; Predicted MWt 35.53 kDa including the tag.
Description:  This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  35.530kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS
Sequence Similarities:  Contains 2 bromo domains.Contains 1 ET domain.
Expression System:  Wheat germ
Protein Length:  90 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  BRD2 bromodomain containing 2 [ Homo sapiens ]
Gene ID NCBI:  6046
Official Symbol:  BRD2
Synonyms:  BRD2; bromodomain containing 2; bromodomain-containing protein 2; D6S113E; FSRG1; KIAA9001; NAT; RING3;
mRNA Refseq:  NM_005104
Protein Refseq:  NP_005095
MIM:  601540
UniProt ID:  P25440
Chromosome Location:  6p21.3
Function:  protein serine/threonine kinase activity;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart