Recombinant Human BAZ2A Protein, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0306
Product Name:  Recombinant Human BAZ2A Protein, GST-tagged
Product Overview:  Human BAZ2A partial ORF ( NP_038477.1, 1681 a.a. - 1780 a.a.) recombinant protein with GST-tag at N-terminal.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  36.74 kDa
Species:  Human
Formulation:  50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Tag:  GST
Amino Acid Sequence:  PKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQKRKSGYSLNFSEGDGRRRRVLLKGRESPAAGPRYSEERLSPSKRRRLSMRNHHSDLTFCEIILM
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  BAZ2A bromodomain adjacent to zinc finger domain, 2A [ Homo sapiens ]
Gene ID NCBI:  11176
Official Symbol:  BAZ2A
Synonyms:  BAZ2A; bromodomain adjacent to zinc finger domain, 2A; bromodomain adjacent to zinc finger domain protein 2A; KIAA0314; TIP5; TTF I interacting peptide 5; WALp3; hWALp3; TTF-I interacting peptide 5; TTF-I-interacting protein 5; transcription termination factor I-interacting protein 5; FLJ13768; FLJ13780; FLJ45876; DKFZp781B109;
mRNA Refseq:  NM_013449
Protein Refseq:  NP_038477
MIM:  605682
UniProt ID:  Q9UIF9

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.