| Cat.No.: | PE-0302 |
| Product Overview: | Human BAZ1B partial ORF ( NP_075381, 1384 a.a. - 1483 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description: | This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 36.74 kDa |
| Species: | Human |
| Formulation: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Tag: | GST |
| Amino Acid Sequence: | MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | BAZ1B bromodomain adjacent to zinc finger domain, 1B [ Homo sapiens ] |
| Gene ID NCBI: | 9031 |
| Official Symbol: | BAZ1B |
| Synonyms: | BAZ1B; bromodomain adjacent to zinc finger domain, 1B; WBSCR9, WBSCR10; tyrosine-protein kinase BAZ1B; transcription factor WSTF; Williams Beuren syndrome chromosome region 9; Williams Beuren syndrome chromosome region 10; WSTF; hWALp2; williams syndrome transcription factor; williams-Beuren syndrome chromosomal region 9 protein; williams-Beuren syndrome chromosomal region 10 protein; WBSCR9; WBSCR10; |
| mRNA Refseq: | NM_032408 |
| Protein Refseq: | NP_115784 |
| MIM: | 605681 |
| UniProt ID: | Q9UIG0 |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0024 | Human BAP1 Knockout Cell Line 109bp insertion | Inquiry |
| CL-0030 | Human BAZ1A Knockout Cell Line 11bp deletion | Inquiry |
| CL-0031 | Human BAZ1B Knockout Cell Line 10bp deletion | Inquiry |
| CL-0032 | Human BAZ2A Knockout Cell Line 16bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0032 | Recombinant Human BAZ2B Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| BAF53A | BAP1 | BAP18 | BARD1 |
| BarX2 | BASP1 | BATZFD | BAZ1A |
| BAZ1B | BAZ2 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.