Recombinant Human BAZ1A Protein, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0296
Product Name:  Recombinant Human BAZ1A Protein, GST-tagged
Product Overview:  Human BAZ1A partial ORF ( NP_038476, 1457 a.a. - 1556 a.a.) recombinant protein with GST-tag at N-terminal.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  36.74 kDa
Species:  Human
Formulation:  50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Tag:  GST
Amino Acid Sequence:  LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  BAZ1A bromodomain adjacent to zinc finger domain, 1A [ Homo sapiens ]
Gene ID NCBI:  11177
Official Symbol:  BAZ1A
Synonyms:  BAZ1A; bromodomain adjacent to zinc finger domain, 1A; bromodomain adjacent to zinc finger domain protein 1A; ACF1; hACF1; WALp1; WCRF180; hWALp1; CHRAC subunit ACF1; ATP-dependent chromatin remodeling protein; ATP-dependent chromatin-remodeling protein; ATP-utilizing chromatin assembly and remodeling factor 1; williams syndrome transcription factor-related chromatin-remodeling factor 180; FLJ14383; DKFZp586E0518;
mRNA Refseq:  NM_013448
Protein Refseq:  NP_038476
MIM:  605680
UniProt ID:  Q9NRL2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.