Recombinant Human DNMT3L


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0281
Product Name:  Recombinant Human DNMT3L
Product Overview:  Recombinant fragment corresponding to aa 288-387 of human Dnmt3L with a proprietary tag; 36.63kDa inclusive of tag;
Description:  CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a nuclear protein with similarity to DNA methyltransferases. This protein is not thought to function as a DNA methyltransferase as it does not contain the amino acid residues necessary for methyltransferase activity. However, this protein does stimulate de novo methylation by DNA cytosine methyltransferase 3 alpha and it is thought to be required for the establishment of maternal genomic imprints. This protein also mediates transcriptional repression through interaction with histone deacetylase 1. Alternative splicing results in two transcript variants. An additional splice variant has been described but its biological validity has not been determined.
Applications:  This product is useful for Antibody Production and Protein Array
Tissue Specificity:  Expressed at low levels in several tissues including testis, ovary, and thymus.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36.630kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  LVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSSRHWALVSEEELSLLAQNKQSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL
Sequence Similarities:  Belongs to the C5-methyltransferase family.Contains 1 ADD-type zinc finger.
Expression System:  Wheat germ
Protein Length:  100 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  DNMT3L DNA (cytosine-5-)-methyltransferase 3-like [ Homo sapiens ]
Gene ID NCBI:  29947
Official Symbol:  DNMT3L
Synonyms:  DNMT3L; DNA (cytosine-5-)-methyltransferase 3-like; DNA (cytosine-5)-methyltransferase 3-like; cytosine 5 methyltransferase 3 like protein; human cytosine 5 methyltransferase 3 like protein; MGC1090;
mRNA Refseq:  NM_013369
Protein Refseq:  NP_037501
MIM:  606588
UniProt ID:  Q9UJW3
Chromosome Location:  21q22.3
Function:  enzyme activator activity; enzyme binding; metal ion binding; protein binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.