| Cat.No.: | PE-0275 |
| Product Name: | Recombinant Human DNMT3B |
| Product Overview: | Recombinant fragment (amino acids 221-320) of Human Dnmt3b with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
| Description: | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined. |
| Tissue Specificity: | Ubiquitous; highly expressed in fetal liver, heart, kidney, placenta, and at lower levels in spleen, colon, brain, liver, small intestine, lung, peripheral blood mononuclear cells, and skeletal muscle. Isoform 1 is expressed in all tissues except brain |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36.630kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | KEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSS |
| Sequence Similarities: | Belongs to the C5-methyltransferase family.Contains 1 ADD domain.Contains 1 GATA-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain. |
| Expression System: | Wheat germ |
| Protein Length: | 100 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | DNMT3B DNA (cytosine-5-)-methyltransferase 3 beta [ Homo sapiens ] |
| Gene ID NCBI: | 1789 |
| Official Symbol: | DNMT3B |
| Synonyms: | DNMT3B; DNA (cytosine-5-)-methyltransferase 3 beta; DNA (cytosine-5)-methyltransferase 3B; |
| mRNA Refseq: | NM_175849 |
| Protein Refseq: | NP_787045 |
| MIM: | 602900 |
| UniProt ID: | Q9UBC3 |
| Chromosome Location: | 20q11.2 |
| Function: | DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0008 | Vinorelbine Tartrate | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0027 | Recombinant Human DNMT3A 293 Cell Lysate | Inquiry |
| EL-0028 | Recombinant Human DNMT3B 293 Cell Lysate | Inquiry |
| EL-0029 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| EL-0030 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| DNA alkyltransferase | DNAJC2 | DNAS1L1 | DNASE1L3 |
| DNMT | DNMT1 | DNMT2 | DNMT3A |
| DNMT3B | DNMT3L | DNMT4 | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools