Recombinant Human DNMT3A, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0267
Product Overview:  Recombinant fragment, corresponding to amino acids 269-546 (278 amino acids) of Human Dnmt3a (Isoform b) with N terminal His tag; MWt 32kDa.
Description:  CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms.
Tissue Specificity:  Highly expressed in fetal tissues, skeletal muscle, heart, peripheral blood mononuclear cells, kidney, and at lower levels in placenta, brain, liver, colon, spleen, small intestine and lung.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  Lyophilised:Reconstitute with 136 μl aqua dest.
Tag:  His
Amino Acid Sequence:  RKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISC GSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQS YCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQ AAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFAN NHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLK DLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRS VTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGT GRLFFEFY
Sequence Similarities:  Belongs to the C5-methyltransferase family.Contains 1 ADD domain.Contains 1 GATA-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain.
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  DNMT3A DNA (cytosine-5-)-methyltransferase 3 alpha [ Homo sapiens ]
Gene ID NCBI:  1788
Official Symbol:  DNMT3A
Synonyms:  DNMT3A; DNA (cytosine-5-)-methyltransferase 3 alpha; DNA (cytosine-5)-methyltransferase 3A;
mRNA Refseq:  NM_022552
Protein Refseq:  NP_072046
MIM:  602769
UniProt ID:  Q9Y6K1
Chromosome Location:  2p23
Function:  DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding; chromatin binding; metal ion binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart