Recombinant Human EZH2 Complex protein, His/Flag-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0236
Product Overview:  Mutant version of EZH2 5-member complex, but with a Pro-to-Ser mutation on a.a. 132 of the EZH2 protein. Complex of human EZH2 (GenBank Accession No. NM_004456), (a.a. 2-end; P132S) with N-terminal His-tag, MW= 86 kDa, human EED (NM_003797) (a.a. 2-end) with N-terminal FLAG-tag, MW= 51 kDa, human SUZ12 (NM_015355) (a.a. 2-end) with N-terminal His-tag, MW = 87 kDa, Human AEBP2 (NM_153207) (a.a. 2-end) with N-terminal His-tag, MW= 53 kDa, and human RbAp48 (NM_005610) (a.a. 2-end) with N-terminal His-tag, MW = 48 kDa, co-expressed in a baculovirus expression system.
Applications:  Useful for Western blot analysis and to investigate protein-protein interactions in the EZH2 complex.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  325 kDa (complex)
Purity:  ≥ 90%
Species:  Human
Formulation:  40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 200 mM imidazole, and 20% glycerol
Tag:  His/Flag
Amino Acid Sequence:  MHHHHHHGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVH ILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNISYMGDEVLDQDG TFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKF PSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKY DCFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNN SSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAE ASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKK DGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDL CLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYD KYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADA LKYVGIEREMEIP
Activity:  0.08 pmol/min/μg
Expression System:  Insect Cells
Protein Length:  2–end (all components)
Concentrations:  0.22 mg/ml
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ]
Gene ID NCBI:  2146
Official Symbol:  EZH2
Synonyms:  EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A; lysine N-methyltransferase 6; ENX1; WVS2; ENX-1; MGC9169;
mRNA Refseq:  NM_004456
Protein Refseq:  NP_004447
MIM:  601573
UniProt ID:  Q15910
Chromosome Location:  7q35-q36
Function:  DNA binding; histone methyltransferase activity; histone-lysine N-methyltransferase activity; methyltransferase activity; protein binding; transferase activity;
Product Types
◆ Bioactive Small Molecules
BSM-0006 GSK343 Inquiry
BSM-0059 3-Deazaneplanocin A Inquiry
BSM-0060 3-Deazaneplanocin A hydrochloride Inquiry
◆ Extracts & Lysates
EL-0024 Recombinant Human EZH1 293 Cell Lysate Inquiry
EL-0025 Recombinant Human EZH2 293 Cell Lysate Inquiry
Related Gene / Proteins
ezh1 EZH2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart