| Cat.No.: | PE-0198 |
| Product Overview: | Recombinant human SIRT6 cDNA (355 aa, Isoform_1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | >90% by SDS-PAGE. |
| Species: | Human |
| Formulation: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Tag: | T7/His |
| Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSV VFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRS GFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDL ALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLE IPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKR VKAKAVPS |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SIRT6 sirtuin 6 [ Homo sapiens ] |
| Gene ID NCBI: | 51548 |
| Official Symbol: | SIRT6 |
| Synonyms: | SIRT6; sirtuin 6; NAD-dependent deacetylase sirtuin-6; sirtuin type 6; SIR2-like protein 6; sir2-related protein type 6; SIR2L6; |
| mRNA Refseq: | NM_001193285 |
| Protein Refseq: | NP_001180214 |
| MIM: | 606211 |
| UniProt ID: | Q8N6T7 |
| Chromosome Location: | 19p13.3 |
| Function: | NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity; NAD+ binding; NAD-dependent histone deacetylase activity; NAD-dependent histone deacetylase activity (H3-K9 specific); hydrolase activity; metal ion binding; protein binding; zinc ion binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
| EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
| EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
| SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
| Related Gene / Proteins | |||
| Siah2 | SIK1 | SIMC1 | SIN3A |
| SIN3B | SIP1 | Sir2p | SIRT |
| SIRT1 | SIRT2 | SIRT3 | SIRT4 |
| SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools