Recombinant Human SIRT6 protein, T7/His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0198
Product Overview:  Recombinant human SIRT6 cDNA (355 aa, Isoform_1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  >90% by SDS-PAGE.
Species:  Human
Formulation:  0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
Tag:  T7/His
Amino Acid Sequence:  MASMTGGQQMGRGHHHHHHGNLYFQGGEFSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSV VFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRS GFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDL ALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLE IPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKR VKAKAVPS
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SIRT6 sirtuin 6 [ Homo sapiens ]
Gene ID NCBI:  51548
Official Symbol:  SIRT6
Synonyms:  SIRT6; sirtuin 6; NAD-dependent deacetylase sirtuin-6; sirtuin type 6; SIR2-like protein 6; sir2-related protein type 6; SIR2L6;
mRNA Refseq:  NM_001193285
Protein Refseq:  NP_001180214
MIM:  606211
UniProt ID:  Q8N6T7
Chromosome Location:  19p13.3
Function:  NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity; NAD+ binding; NAD-dependent histone deacetylase activity; NAD-dependent histone deacetylase activity (H3-K9 specific); hydrolase activity; metal ion binding; protein binding; zinc ion binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart