Recombinant Human SIRT4


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0172
Product Name:  Recombinant Human SIRT4
Product Overview:  Recombinant full length Human SIRT4 with an N terminal proprietary tag; predicted MWt 62 kDa inclusive of tag;
Description:  This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.
Tissue Specificity:  Detected in vascular smooth muscle and striated muscle. Detected in insulin-producing beta-cells in pancreas islets of Langerhans (at protein level). Widely expressed. Weakly expressed in leukocytes and fetal thymus.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  62.000kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC
Sequence Similarities:  Belongs to the sirtuin family.Contains 1 deacetylase sirtuin-type domain.
Expression System:  E. coli
Protein Length:  314 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SIRT4 sirtuin 4 [ Homo sapiens ]
Gene ID NCBI:  23409
Official Symbol:  SIRT4
Synonyms:  SIRT4; sirtuin 4; sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 4; NAD-dependent ADP-ribosyltransferase sirtuin-4; SIR2L4;
mRNA Refseq:  NM_012240
Protein Refseq:  NP_036372
MIM:  604482
UniProt ID:  Q9Y6E7
Chromosome Location:  12q24.31
Function:  NAD+ ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity; NAD+ binding; NOT NAD-dependent protein deacetylase activity; metal ion binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.