Recombinant Human SIRT3, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0159
Product Name:  Recombinant Human SIRT3, His-tagged
Product Overview:  Recombinant fragment of Human SIRT3 with N terminal His tag; 303aa, 33.5kDa.
Description:  This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene.
Tissue Specificity:  Widely expressed.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  33.500kDa inclusive of tags
Purity:  >95% by SDS-PAGE
Species:  Human
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFF HNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Sequence Similarities:  Belongs to the sirtuin family.Contains 1 deacetylase sirtuin-type domain.
Expression System:  E. coli
Protein Length:  282 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SIRT3 sirtuin 3 [ Homo sapiens ]
Gene ID NCBI:  23410
Official Symbol:  SIRT3
Synonyms:  SIRT3; sirtuin 3; sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3; NAD-dependent deacetylase sirtuin-3, mitochondrial; SIR2L3;
mRNA Refseq:  NM_001017524
Protein Refseq:  NP_001017524
MIM:  604481
UniProt ID:  Q9NTG7
Chromosome Location:  11p15.5
Function:  NOT NAD+ ADP-ribosyltransferase activity; NAD+ binding; hydrolase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides; metal ion binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.