Recombinant Human SIRT2 protein, T7/His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0151
Product Name:  Recombinant Human SIRT2 protein, T7/His-tagged
Product Overview:  Recombinant human SIRT2 cDNA (389aa, isoform-2) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  >90% by SDS-PAGE.
Species:  Human
Formulation:  0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Tag:  T7/His
Amino Acid Sequence:  MASMTGGQQMGRGHHHHHHGNLYFQGGEFDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVG AGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKG LLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVF FGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDF DSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPPAKDEARTTE REKPQ
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SIRT2 sirtuin 2 [ Homo sapiens ]
Gene ID NCBI:  22933
Official Symbol:  SIRT2
Synonyms:  SIRT2; sirtuin 2; NAD-dependent deacetylase sirtuin-2; sirtuin type 2; SIR2-like protein 2; SIR2; SIR2L; SIR2L2; FLJ35621; FLJ37491;
mRNA Refseq:  NM_030593
Protein Refseq:  NP_085096
MIM:  604480
UniProt ID:  Q8IXJ6
Chromosome Location:  19q13
Function:  NOT NAD+ ADP-ribosyltransferase activity; NAD+ binding; NAD-dependent histone deacetylase activity; histone acetyltransferase binding; histone deacetylase binding; hydrolase activity; metal ion binding; protein binding; protein deacetylase activity; transcription factor binding; tubulin deacetylase activity; ubiquitin binding; zinc ion binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.