| Cat.No.: | PE-0009 |
| Product Name: | Recombinant Human MBD4 protein, T7/His-tagged |
| Product Overview: | Recombinant human MBD4 cDNA (580aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Purity: | >90% by SDS-PAGE |
| Species: | Human |
| Formulation: | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Tag: | T7/His |
| Amino Acid Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVG EDEEQMMIKRSSECNPLLQEPIASAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKS SLANYLHKNGETSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRTRSKCKKDVFMPPSSSSE LQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKAD AESEPVAQKSQLDRTVCISDAGACGETLSVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEK YEDTFLESEEIGTKVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSSKY NKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWR DVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWE NHEKLSLS |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | MBD4 methyl-CpG binding domain protein 4 [ Homo sapiens ] |
| Gene ID NCBI: | 8930 |
| Official Symbol: | MBD4 |
| Synonyms: | MBD4; methyl-CpG binding domain protein 4; methyl-CpG-binding domain protein 4; MED1; G/T mismatch glycosylase; G/U mismatch glycosylase; methyl-CpG-binding protein MBD4; 3,N(4)-ethenocytosine glycosylase; methyl-CpG-binding endonuclease 1; mismatch-specific DNA N-glycosylase; putative methyl-CpG binding protein; G/5-fluorouracil mismatch glycosylase with biphasic kinetics; |
| mRNA Refseq: | NM_003925 |
| Protein Refseq: | NP_003916 |
| MIM: | 603574 |
| UniProt ID: | O95243 |
| Chromosome Location: | 3q21.3 |
| Function: | DNA binding; catalytic activity; endodeoxyribonuclease activity; hydrolase activity; protein binding; satellite DNA binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0001 | Recombinant Human MBD1 Cell Lysate | Inquiry |
| EL-0002 | Recombinant Human MBD3 Cell Lysate | Inquiry |
| EL-0003 | Recombinant Human MBD3L1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0001 | Recombinant Chicken MBD2 | Inquiry |
| PE-0002 | Recombinant Zebrafish MBD2 | Inquiry |
| Related Gene / Proteins | |||
| MBD1 | mbd2 | MBD3 | MBD3L1 |
| MBD3L2 | MBD3L3 | MBD3L4 | MBD3L5 |
| MBD4 | MBD5 | MBD6 | MBIP |
| MBTD1 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
