Recombinant Human MBD3 protein, T7/His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0007
Product Overview:  Recombinant human MBD3 cDNA (259aa, Isoform-II, derived from BC043619) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Purity:  >90% by SDS-PAGE
Species:  Human
Formulation:  1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Tag:  T7/His
Amino Acid Sequence:  MASMTGGQQMGRGHHHHHHENLYFQGGEFERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQ RVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEE LVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQE ELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV
Expression System:  E. coli
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ]
Gene ID NCBI:  8931
Official Symbol:  MBD3
Synonyms:  MBD3; methyl-CpG binding domain protein 3;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart