| Cat.No.: | PE-0003 |
| Product Name: | Recombinant Human MBD3, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 164-291 of Human MBD3 with N terminal His tag; Predicted MWt 15 kDa. |
| Description: | DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3.MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 86 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKN PGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEE ALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEE EEPDPDPEMEHV |
| Sequence Similarities: | Contains 1 MBD (methyl-CpG-binding) domain. |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ] |
| Gene ID NCBI: | 53615 |
| Official Symbol: | MBD3 |
| Synonyms: | MBD3; methyl-CpG binding domain protein 3; methyl-CpG-binding domain protein 3; |
| mRNA Refseq: | NM_003926 |
| Protein Refseq: | NP_003917 |
| MIM: | 603573 |
| UniProt ID: | O95983 |
| Chromosome Location: | 19p13 |
| Function: | DNA binding; chromatin binding; protein binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0001 | Recombinant Human MBD1 Cell Lysate | Inquiry |
| EL-0002 | Recombinant Human MBD3 Cell Lysate | Inquiry |
| EL-0003 | Recombinant Human MBD3L1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0001 | Recombinant Chicken MBD2 | Inquiry |
| PE-0002 | Recombinant Zebrafish MBD2 | Inquiry |
| Related Gene / Proteins | |||
| MBD1 | mbd2 | MBD3 | MBD3L1 |
| MBD3L2 | MBD3L3 | MBD3L4 | MBD3L5 |
| MBD4 | MBD5 | MBD6 | MBIP |
| MBTD1 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools