CHD1 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3502
Antibody Type:  Polyclonal
Immunogen:  A synthetic peptide corresponding to a sequence within amino acids 1600 to the C-terminus of human CHD1
Immunogen Sequence:  DREKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKSTPEHTWSSRKT
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  197kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IHC
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000; IHC: 1:100 - 1:200
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  HeLa,Jurkat,K-562
Species Reactivity:  Human, Mouse, Rat
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot O14646; NP_001261.2; Gene ID 1105
Alternative Name:  CHD1; chromodomain-helicase-DNA-binding protein 1
Scientific Background:  The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.