| Cat.No.: | EAb-3501 |
| Product Overview: | Polyclonal Antibody to detect CBX2 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 62-211 of human CBX2 |
| Immunogen Sequence: | EHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSPPLPGASCFSLSCTPLCWVAGSNCCRQALFPPRGSLGDGKEQEACVQ |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 65kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | HeLa,K-562,MCF7,BT-474 |
| Species Reactivity: | Human |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q14781; NP_116036.1; Gene ID 84733 |
| Alternative Name: | CBX2; CDCA6; M33; SRXY5; chromobox 2 |
| Scientific Background: | This gene encodes a component of the polycomb multiprotein complex, which is required to maintain the transcriptionally repressive state of many genes throughout development via chromatin remodeling and modification of histones. Disruption of this gene in mice results in male-to-female gonadal sex reversal. Mutations in this gene are also associated with gonadal dysgenesis in humans. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0053 | Human CBX5 Knockout Cell Line 2bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0146 | CBX5 Polyclonal Antibody | Inquiry |
| EAb-0148 | CBX3 Polyclonal Antibody | Inquiry |
| EAb-0150 | CBX2 Polyclonal Antibody | Inquiry |
| EAb-0153 | CBFb Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| CBFb | CBX2 | CBX3 | CBX4 |
| CBX5 | CBX6 | CBX7 | CBX8 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.