| Cat.No.: | EAb-3498 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human PHF1 |
| Immunogen Sequence: | MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRLVSCEKCRHAYHQDCHVPRAPAPGEGEGTSWVCRQCVFAIATKRGGALKKGPYARAMLGMKLSLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLKMLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLY |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 68kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | A-549,HeLa,Mouse lung |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot O43189; NP_077084.1; Gene ID 5252 |
| Alternative Name: | PHF1; MTF2L2; PCL1; PHF2; TDRD19C; hPHF1; PHD finger protein 1 |
| Scientific Background: | This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0056 | PHF8 Polyclonal Antibody | Inquiry |
| EAb-0058 | PHC2 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0114 | DMOG | Inquiry |
| ◆ Cell Lines | ||
| CL-0115 | Human PHF6 Knockout Cell Line 1bp deletion | Inquiry |
| CL-0116 | Human PHIP Knockout Cell Line 2bp deletion | Inquiry |
| Related Gene / Proteins | |||
| PHB | PHC1 | PHC2 | PHD |
| PHD1 | PHD2 | PHD3 | PHF1 |
| PHF10 | PHF13 | PHF17 | PHF2 |
| PHF20 | PHF20B | PHF21A | PHF21B |
| PHF6 | PHF8 | PHIP | PHPT1 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools