| Cat.No.: | EAb-3491 |
| Product Name: | ASF1B Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 63-202 of human ASF1B |
| Immunogen Sequence: | GPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 17kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:200 - 1:1000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | HeLa,MCF7,THP-1 |
| Species Reactivity: | Human |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q9NVP2; NP_060624.1; Gene ID 55723 |
| Alternative Name: | ASF1B; CIA-II; histone chaperone ASF1B |
| Scientific Background: | This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0018 | Human ASH1L Knockout Cell Line 53bp deletion | Inquiry |
| CL-0019 | Human ASXL2 Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0162 | Recombinant Human ASH2L 293 Cell Lysate | Inquiry |
| EL-0173 | Recombinant Human ASF1A 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0168 | ASH2 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| ASB10 | ASB11 | ASB13 | ASB6 |
| ASB7 | ASB8 | ASB9 | ASF1 |
| ASH1L | ASH2 | ASXL2 | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
