SMARCAL1 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3488
Antibody Type:  Polyclonal
Immunogen:  A synthetic peptide corresponding to a sequence within amino acids 800-900 of human SMARCAL1
Immunogen Sequence:  VFAELFWNPGVLIQAEDRVHRIGQTSSVGIHYLVAKGTADDYLWPLIQEKIKVLAEAGLSETNFSEMTESTDYLYKDPKQQKIYDLFQKSFEKEGSDMELL
Host:  Rabbit
Isotype:  IgG
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Species Reactivity:  Human, Mouse
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q9NZC9; NP_001120679.1; Gene ID 50485
Alternative Name:  SMARCAL1; HARP; HHARP; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a like 1
Scientific Background:  The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E. coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.