| Cat.No.: | EAb-3472 |
| Product Name: | CHD2 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-223 of human CHD2 |
| Immunogen Sequence: | MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESEQGSDPGSGHGSESNSSSESSESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPSRFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQEPSEDEQEQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRGKRKKQDSSDEDDDDDEAPKRQTR |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 260kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | Jurkat,DU145,SW620,Mouse lung,Rat brain |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot O14647; NP_001036037.1; Gene ID 1106 |
| Alternative Name: | CHD2; EEOC; chromodomain-helicase-DNA-binding protein 2 |
| Scientific Background: | The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0147 | Recombinant Human CHAF1A 293 Cell Lysate | Inquiry |
| EL-0167 | Recombinant Human CHAF1B 293 Cell Lysate | Inquiry |
| EL-0211 | Recombinant Human CHD2 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0180 | Mouse Chd7 peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0199 | CHRDL1 Monoclonal Antibody (3H1-F6-A10) | Inquiry |
| Related Gene / Proteins | |||
| CHAF1A | CHAF1B | CHD1 | CHD2 |
| CHD3 | CHD4 | CHD5 | Chd7 |
| CHD8 | CHD9 | CHEK2 | CHRAC1 |
| CHRDL1 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools