Cat.No.: | EAb-3471 |
Product Name: | PBRM1 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human PBRM1 |
Immunogen Sequence: | MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDL |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 230kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | HeLa,Jurkat,BT-474,NIH/3T3,LO2,Mouse lung,Mouse thymus,Rat liver |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot Q86U86; NP_060783.3; Gene ID 55193 |
Alternative Name: | PBRM1; BAF180; PB1; polybromo 1 |
Scientific Background: | This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma. |
Product Types | ||
◆ Cell Lines | ||
CL-0114 | Human PBRM1 Knockout Cell Line 8bp deletion | Inquiry |
◆ Proteins & Enzymes | ||
PE-1119 | Recombinant Zebrafish PBRM1L | Inquiry |
PE-1695 | PB1 (BD4), His-tag | Inquiry |
PE-1717 | PB1 (BD6), His-tag | Inquiry |
◆ Antibodies | ||
EAb-1869 | PBX2 Monoclonal Antibody | Inquiry |
Related Gene / Proteins | |||
PB1 | PBI | PBRM1 | PBRM1L |
PBX | PBX1b | PBX2 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools