PBRM1 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3471
Antibody Type:  Polyclonal
Immunogen:  Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human PBRM1
Immunogen Sequence:  MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDL
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  230kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  HeLa,Jurkat,BT-474,NIH/3T3,LO2,Mouse lung,Mouse thymus,Rat liver
Species Reactivity:  Human, Mouse, Rat
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q86U86; NP_060783.3; Gene ID 55193
Alternative Name:  PBRM1; BAF180; PB1; polybromo 1
Scientific Background:  This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma.
Product Types
◆ Cell Lines
CL-0114 Human PBRM1 Knockout Cell Line 8bp deletion Inquiry
◆ Proteins & Enzymes
PE-1119 Recombinant Zebrafish PBRM1L Inquiry
PE-1695 PB1 (BD4), His-tag Inquiry
PE-1717 PB1 (BD6), His-tag Inquiry
◆ Antibodies
EAb-1869 PBX2 Monoclonal Antibody Inquiry
Related Gene / Proteins
PB1 PBI PBRM1 PBRM1L
PBX PBX1b PBX2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.