| Cat.No.: | EAb-3471 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human PBRM1 |
| Immunogen Sequence: | MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDL |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 230kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | HeLa,Jurkat,BT-474,NIH/3T3,LO2,Mouse lung,Mouse thymus,Rat liver |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q86U86; NP_060783.3; Gene ID 55193 |
| Alternative Name: | PBRM1; BAF180; PB1; polybromo 1 |
| Scientific Background: | This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0114 | Human PBRM1 Knockout Cell Line 8bp deletion | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-1119 | Recombinant Zebrafish PBRM1L | Inquiry |
| PE-1695 | PB1 (BD4), His-tag | Inquiry |
| PE-1717 | PB1 (BD6), His-tag | Inquiry |
| ◆ Antibodies | ||
| EAb-1869 | PBX2 Monoclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| PB1 | PBI | PBRM1 | PBRM1L |
| PBX | PBX1b | PBX2 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.
