Cat.No.: | EAb-3465 |
Product Name: | MTA2 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human MTA2 |
Immunogen Sequence: | DSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWD |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 72kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | Jurkat,Mouse thymus |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot O94776; NP_004730.2; Gene ID 9219 |
Alternative Name: | MTA2; MTA1L1; PID; metastasis-associated protein MTA2 |
Scientific Background: | This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may represent one member of a small gene family that encode different but related proteins involved either directly or indirectly in transcriptional regulation. Their indirect effects on transcriptional regulation may include chromatin remodeling. It is closely related to another member of this family, a protein that has been correlated with the metastatic potential of certain carcinomas. These two proteins are so closely related that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. One of the proteins known to be a target protein for this gene product is p53. Deacetylation of p53 is correlated with a loss of growth inhibition in transformed cells supporting a connection between these gene family members and metastasis. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0065 | 5’-Deoxy-5’-methylthioadenosine | Inquiry |
◆ Extracts & Lysates | ||
EL-0165 | Recombinant Human MTF1 293 Cell Lysate | Inquiry |
EL-0195 | Recombinant Human MTA1 293 Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0325 | MTF2 Polyclonal Antibody | Inquiry |
◆ Proteins & Enzymes | ||
PE-0435 | Recombinant Human MTA2, GST-tagged | Inquiry |
Related Gene / Proteins | |||
MTA | MTA1 | MTA2 | MTA3 |
MTF1 | MTF2 | MTR |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools