CHD1 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3450
Antibody Type:  Polyclonal
Immunogen:  Recombinant fusion protein containing a sequence corresponding to amino acids 1501-1710 of human CHD1
Immunogen Sequence:  IKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKSTPEHTWSSRKT
Host:  Rabbit
Isotype:  IgG
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IF
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Species Reactivity:  Human
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot O14646; NP_001261.2; Gene ID 1105
Alternative Name:  CHD1; chromodomain-helicase-DNA-binding protein 1
Scientific Background:  The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.