| Cat.No.: | EAb-3450 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1501-1710 of human CHD1 |
| Immunogen Sequence: | IKKRQESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKSTPEHTWSSRKT |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IF |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Species Reactivity: | Human |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot O14646; NP_001261.2; Gene ID 1105 |
| Alternative Name: | CHD1; chromodomain-helicase-DNA-binding protein 1 |
| Scientific Background: | The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0147 | Recombinant Human CHAF1A 293 Cell Lysate | Inquiry |
| EL-0167 | Recombinant Human CHAF1B 293 Cell Lysate | Inquiry |
| EL-0211 | Recombinant Human CHD2 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0180 | Mouse Chd7 peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0199 | CHRDL1 Monoclonal Antibody (3H1-F6-A10) | Inquiry |
| Related Gene / Proteins | |||
| CHAF1A | CHAF1B | CHD1 | CHD2 |
| CHD3 | CHD4 | CHD5 | Chd7 |
| CHD8 | CHD9 | CHEK2 | CHRAC1 |
| CHRDL1 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.