| Cat.No.: | EAb-3449 |
| Product Name: | PHC2 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human PHC2 |
| Immunogen Sequence: | MTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLELPDMH |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 37kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | HT-29,HeLa,MCF7,Mouse brain |
| Species Reactivity: | Human, Mouse |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q8IXK0; NP_004418.2; Gene ID 1912 |
| Alternative Name: | PHC2; EDR2; HPH2; PH2; polyhomeotic homolog 2 |
| Scientific Background: | In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0056 | PHF8 Polyclonal Antibody | Inquiry |
| EAb-0058 | PHC2 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0114 | DMOG | Inquiry |
| ◆ Cell Lines | ||
| CL-0115 | Human PHF6 Knockout Cell Line 1bp deletion | Inquiry |
| CL-0116 | Human PHIP Knockout Cell Line 2bp deletion | Inquiry |
| Related Gene / Proteins | |||
| PHB | PHC1 | PHC2 | PHD |
| PHD1 | PHD2 | PHD3 | PHF1 |
| PHF10 | PHF13 | PHF17 | PHF2 |
| PHF20 | PHF20B | PHF21A | PHF21B |
| PHF6 | PHF8 | PHIP | PHPT1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools