PHC2 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3449
Antibody Type:  Polyclonal
Immunogen:  Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human PHC2
Immunogen Sequence:  MTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKLPQQDHTTTTDSEMEEPYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLELPDMH
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  37kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  HT-29,HeLa,MCF7,Mouse brain
Species Reactivity:  Human, Mouse
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q8IXK0; NP_004418.2; Gene ID 1912
Alternative Name:  PHC2; EDR2; HPH2; PH2; polyhomeotic homolog 2
Scientific Background:  In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart