CHD3 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3443
Antibody Type:  Polyclonal
Immunogen:  A synthetic peptide corresponding to a sequence within amino acids 1900-2000 of human CHD3
Immunogen Sequence:  ERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  280kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB
Recommended Dilutions/Conditions:  WB: 1:200 - 1:1000
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  Jurkat,Mouse brain,Rat brain
Species Reactivity:  Human, Mouse, Rat
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q12873; NP_001005273.1; Gene ID 1107
Alternative Name:  CHD3; Mi-2a; Mi2-ALPHA; ZFH; chromodomain-helicase-DNA-binding protein 3
Scientific Background:  This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.