| Cat.No.: | EAb-3437 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-425 of human RBBP4 |
| Immunogen Sequence: | MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 48kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IF; ChIP |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; ChIP: 1:20 - 1:50 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | SW480,HeLa,Jurkat,293T |
| Species Reactivity: | Human |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q09028; NP_005601.1; Gene ID 5928 |
| Alternative Name: | RBBP4; NURF55; RBAP48; lin-53; histone-binding protein RBBP4 |
| Scientific Background: | This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0043 | RBBP4 Polyclonal Antibody | Inquiry |
| EAb-0181 | RBM26 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0047 | Recombinant Human RBBP4 Cell Lysate | Inquiry |
| EL-0216 | Recombinant Human RBBP5 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0118 | Human RBBP7 Knockout Cell Line 5bp deletion | Inquiry |
| Related Gene / Proteins | |||
| RB1 | RbAp46 | RbAp48 | RBB4L |
| RBBP2 | RBBP4 | RBBP5 | RBBP7 |
| RBBP9 | RBM11 | RBM18 | RBM26 |
| RBM3 | RBM34 | RBM38 | RBM39 |
| RBM41 | RBM42 | RBM46 | RBM5 More > |
| RBM7 | RBMS1 | RBMS2 | RBMS3 |
| RBMY1A1 | RBMY1F | RBPJ | RBPMS |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.