| Cat.No.: | EAb-3432 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-194 of human MBD3L1 |
| Immunogen Sequence: | MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEKR |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 22kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:1000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | Mouse brain,Rat testis,Rat brain |
| Species Reactivity: | Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q8WWY6; NP_660209.2; Gene ID 85509 |
| Alternative Name: | MBD3L1; MBD3L; methyl-CpG-binding domain protein 3-like 1 |
| Scientific Background: | This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0001 | Recombinant Human MBD1 Cell Lysate | Inquiry |
| EL-0002 | Recombinant Human MBD3 Cell Lysate | Inquiry |
| EL-0003 | Recombinant Human MBD3L1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0001 | Recombinant Chicken MBD2 | Inquiry |
| PE-0002 | Recombinant Zebrafish MBD2 | Inquiry |
| Related Gene / Proteins | |||
| MBD1 | mbd2 | MBD3 | MBD3L1 |
| MBD3L2 | MBD3L3 | MBD3L4 | MBD3L5 |
| MBD4 | MBD5 | MBD6 | MBIP |
| MBTD1 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.