| Cat.No.: | EAb-3427 |
| Product Name: | WHSC1 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human WHSC1 |
| Immunogen Sequence: | MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 80kDa, 152kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | HeLa,HepG2,SW620,Mouse brain,Mouse spleen |
| Species Reactivity: | Human, Mouse |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot O96028; NP_579877.1; Gene ID 7468 |
| Alternative Name: | NSD2; KMT3F; KMT3G; MMSET; REIIBP; TRX5; WHS; WHSC1; histone-lysine N-methyltransferase NSD2 |
| Scientific Background: | This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0127 | Recombinant Human WHSC1L1 293 Cell Lysate | Inquiry |
| EL-0128 | Recombinant Human WHSC1L1 293 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0222 | Human WHSC1L1 Knockout Cell Line 10bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0890 | WHSC1L1 Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-0892 | WHSC1L1 Polyclonal Antibody, FITC Conjugated | Inquiry |
| Related Gene / Proteins | |||
| WHSC1 | WHSC1L1 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
