Cat.No.: | EAb-3423 |
Product Name: | KMT5C Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C |
Immunogen Sequence: | FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 52kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | 293T,HeLa,K-562,SH-SY5Y,Mouse brain |
Species Reactivity: | Human, Mouse |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot Q86Y97; NP_116090.2; Gene ID 84787 |
Alternative Name: | KMT5C; SUV420H2; Suv4-20h2; lysine methyltransferase 5C |
Scientific Background: | SUV420H2 and the related enzyme SUV420H1 function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 on lysine-20 (K20). |
Product Types | ||
◆ Antibodies | ||
EAb-0020 | Suz12 Polyclonal Antibody | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0100 | Chaetocin | Inquiry |
◆ Extracts & Lysates | ||
EL-0103 | Recombinant Human SUZ12 293 Cell Lysate | Inquiry |
EL-0132 | Recombinant Human SUV39H1 293 Cell Lysate | Inquiry |
EL-0137 | Recombinant Human SUV420H1 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
SUDS3 | SUMO | SUMO1 | SUMO2 |
SUMO3 | SUN1 | Surf6 | suv39h1 |
SUV39H2 | SUV3L1 | SUV420H1 | SUV420H2 |
SUZ12 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools