KMT5C Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3423
Antibody Type:  Polyclonal
Immunogen:  A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C
Immunogen Sequence:  FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  52kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  293T,HeLa,K-562,SH-SY5Y,Mouse brain
Species Reactivity:  Human, Mouse
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q86Y97; NP_116090.2; Gene ID 84787
Alternative Name:  KMT5C; SUV420H2; Suv4-20h2; lysine methyltransferase 5C
Scientific Background:  SUV420H2 and the related enzyme SUV420H1 function as histone methyltransferases that specifically trimethylate nucleosomal histone H4 on lysine-20 (K20).

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart