Cat.No.: | EAb-3413 |
Product Name: | KDM4C Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 350-570 of human KDM4C |
Immunogen Sequence: | PASTPEVKAWLQRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAVKLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSISSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLEPGEIPAVPSGERNSFKVPSIAEGENKTSKS |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | IF |
Species Reactivity: | Human, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot Q9H3R0; NP_055876.2; Gene ID 23081 |
Alternative Name: | GASC1; JHDM3C; JMJD2C; TDRD14C |
Scientific Background: | This gene is a member of the Jumonji domain 2 (JMJD2) family. The encoded protein is a trimethylation-specific demethylase, and converts specific trimethylated histone residues to the dimethylated form. This enzymatic action regulates gene expression and chromosome segregation. Chromosomal aberrations and changes in expression of this gene may be found in tumor cells. Alternative splicing results in multiple transcript variants. |
Product Types | ||
◆ Cell Lines | ||
CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
KDM1 | KDM1A | KDM1B | KDM2 |
KDM2A | KDM2B | KDM3A | KDM3B |
KDM4 | KDM4A | KDM4B | KDM4C |
KDM4D | KDM4E | KDM5 | KDM5A |
KDM5B | KDM5C | KDM5D | KDM6A More > |
KDM6B | KDM6C | KDM7 | KDM7A |
KDM7B | KDM8 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools