Cat.No.: | EAb-3386 |
Product Name: | CENPA Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA |
Immunogen Sequence: | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 16kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IF |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | Jurkat |
Species Reactivity: | Human |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot P49450; NP_001800.1; Gene ID 1058 |
Alternative Name: | CENPA; CENP-A; CenH3; centromere protein A |
Scientific Background: | Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Product Types | ||
◆ Cell Lines | ||
CL-0054 | Human CECR2 Knockout Cell Line 13bp deletion | Inquiry |
◆ Synthetic Peptides | ||
SP-0191 | Human CENPA peptide | Inquiry |
◆ Extracts & Lysates | ||
EL-0219 | Recombinant Human CENPA 293 Cell Lysate | Inquiry |
EL-0220 | Recombinant Human CENPA 293 Cell Lysate | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0340 | NVS-CECR2-1 | Inquiry |
Related Gene / Proteins | |||
CEACAM1 | CECR1 | CECR2 | CELF-5 |
CELF-6 | CENH3 | CENPA | CENPB |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools