CENPA Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3386
Product Name:  CENPA Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA
Immunogen Sequence:  MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  16kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IF
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  Jurkat
Species Reactivity:  Human
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot P49450; NP_001800.1; Gene ID 1058
Alternative Name:  CENPA; CENP-A; CenH3; centromere protein A
Scientific Background:  Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Types
◆ Cell Lines
CL-0054 Human CECR2 Knockout Cell Line 13bp deletion Inquiry
◆ Synthetic Peptides
SP-0191 Human CENPA peptide Inquiry
◆ Extracts & Lysates
EL-0219 Recombinant Human CENPA 293 Cell Lysate Inquiry
EL-0220 Recombinant Human CENPA 293 Cell Lysate Inquiry
◆ Bioactive Small Molecules
BSM-0340 NVS-CECR2-1 Inquiry
Related Gene / Proteins
CEACAM1 CECR1 CECR2 CELF-5
CELF-6 CENH3 CENPA CENPB

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.