| Cat.No.: | EAb-3386 |
| Antibody Type: | Polyclonal |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CENPA |
| Immunogen Sequence: | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 16kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IF |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | Jurkat |
| Species Reactivity: | Human |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot P49450; NP_001800.1; Gene ID 1058 |
| Alternative Name: | CENPA; CENP-A; CenH3; centromere protein A |
| Scientific Background: | Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0054 | Human CECR2 Knockout Cell Line 13bp deletion | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0191 | Human CENPA peptide | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0219 | Recombinant Human CENPA 293 Cell Lysate | Inquiry |
| EL-0220 | Recombinant Human CENPA 293 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0340 | NVS-CECR2-1 | Inquiry |
| Related Gene / Proteins | |||
| CEACAM1 | CECR1 | CECR2 | CELF-5 |
| CELF-6 | CENH3 | CENPA | CENPB |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.