Cat.No.: | EAb-3365 |
Product Name: | EP300 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human EP300 |
Immunogen Sequence: | MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGL |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 280kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IHC; IF |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | Mouse brain,Rat brain |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot Q09472; NP_001420.2; Gene ID 2033 |
Alternative Name: | EP300; KAT3B; RSTS2; p300; E1A binding protein p300 |
Scientific Background: | This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0038 | CTPB | Inquiry |
BSM-0073 | Anacardic Acid | Inquiry |
BSM-0094 | C646 | Inquiry |
BSM-0108 | Curcumin, Curcuma longa (High Purity) | Inquiry |
◆ Cell Lines | ||
CL-0061 | Human EP300 Knockout Cell Line 13bp deletion | Inquiry |
Related Gene / Proteins | |||
EP300 | EPC1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools