Cat.No.: | EAb-3363 |
Product Name: | KDM1 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 130-380 of human KDM1 |
Immunogen Sequence: | LSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQ |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 110kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IHC; IF |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:100 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | U-87MG,HeLa,Jurkat,Mouse liver |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot O60341; NP_055828.2; Gene ID 23028 |
Alternative Name: | KDM1A; AOF2; BHC110; CPRF; KDM1; LSD1; lysine demethylase 1A |
Scientific Background: | This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants. |
Product Types | ||
◆ Cell Lines | ||
CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
KDM1 | KDM1A | KDM1B | KDM2 |
KDM2A | KDM2B | KDM3A | KDM3B |
KDM4 | KDM4A | KDM4B | KDM4C |
KDM4D | KDM4E | KDM5 | KDM5A |
KDM5B | KDM5C | KDM5D | KDM6A More > |
KDM6B | KDM6C | KDM7 | KDM7A |
KDM7B | KDM8 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools