KDM1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3363
Product Name:  KDM1 Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  Recombinant fusion protein containing a sequence corresponding to amino acids 130-380 of human KDM1
Immunogen Sequence:  LSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQ
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  110kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IHC; IF
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000; IHC: 1:50 - 1:100
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  U-87MG,HeLa,Jurkat,Mouse liver
Species Reactivity:  Human, Mouse, Rat
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot O60341; NP_055828.2; Gene ID 23028
Alternative Name:  KDM1A; AOF2; BHC110; CPRF; KDM1; LSD1; lysine demethylase 1A
Scientific Background:  This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.