TET2 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3361
Antibody Type:  Polyclonal
Immunogen:  Recombinant fusion protein containing a sequence corresponding to amino acids 1833-2002 of human TET2
Immunogen Sequence:  VQGVASGAEDNDEVWSDSEQSFLDPDIGGVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAKMAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTTDSTVTTSPYAFTRVTGPYNRYI
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  300kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IHC
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000; IHC: 1:100 - 1:200
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  A-549
Species Reactivity:  Human, Mouse, Rat
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q6N021; NP_001120680.1; Gene ID 54790
Alternative Name:  TET2; KIAA1546; MDS; methylcytosine dioxygenase TET2
Scientific Background:  The protein encoded by this gene is a methylcytosine dioxygenase that catalyzes the conversion of methylcytosine to 5-hydroxymethylcytosine. The encoded protein is involved in myelopoiesis, and defects in this gene have been associated with several myeloproliferative disorders. Two variants encoding different isoforms have been found for this gene.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.