| Cat.No.: | EAb-3361 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1833-2002 of human TET2 |
| Immunogen Sequence: | VQGVASGAEDNDEVWSDSEQSFLDPDIGGVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAKMAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTTDSTVTTSPYAFTRVTGPYNRYI |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 300kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:100 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | A-549 |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q6N021; NP_001120680.1; Gene ID 54790 |
| Alternative Name: | TET2; KIAA1546; MDS; methylcytosine dioxygenase TET2 |
| Scientific Background: | The protein encoded by this gene is a methylcytosine dioxygenase that catalyzes the conversion of methylcytosine to 5-hydroxymethylcytosine. The encoded protein is involved in myelopoiesis, and defects in this gene have been associated with several myeloproliferative disorders. Two variants encoding different isoforms have been found for this gene. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0154 | Recombinant Human TET3 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0176 | TEAD2 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0215 | Human TET1 Knockout Cell Line 1bp insertion | Inquiry |
| CL-0217 | Human TET2 Knockout Cell Line 19bp deletion | Inquiry |
| CL-0218 | Human TET3 Knockout Cell Line 14bp deletion | Inquiry |
| Related Gene / Proteins | |||
| TEAD1 | TEAD2 | telomerase | TEN1 |
| TENR | TERF2IP | TET | TET1 |
| TET2 | TET3 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.