Cat.No.: | EAb-3360 |
Product Name: | KAT7 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 55-193 of human KAT7 |
Immunogen Sequence: | DSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSL |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 63kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IF |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | BT-474,HepG2,293T,HeLa |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot O95251; NP_008998.1; Gene ID 11143 |
Alternative Name: | KAT7; HBO1; HBOA; MYST2; ZC2HC7; lysine acetyltransferase 7 |
Scientific Background: | The protein encoded by this gene is part of the multimeric HBO1 complex, which possesses histone H4-specific acetyltransferase activity. This activity is required for functional replication origins and is involved in transcriptional activation of some genes. In both cases, the acetylation of histone H4 helps unfold chromatin so that the DNA can be accessed and replicated or transcribed. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0073 | Anacardic Acid | Inquiry |
◆ Antibodies | ||
EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
◆ Extracts & Lysates | ||
EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
Kaiso | KANSL2 | KAP1 | KAT13A |
KAT13D | KAT2A | KAT2B | KAT4 |
KAT5 | KAT6A | KAT6B | KAT7 |
KAT8 | KAT9 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools