Cat.No.: | EAb-3351 |
Product Name: | DOT1L Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human DOT1L |
Immunogen Sequence: | MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVD |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 170kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | Mouse liver |
Species Reactivity: | Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot Q8TEK3; NP_115871.1; Gene ID 84444 |
Alternative Name: | DOT1L; DOT1; KMT4; DOT1 like histone lysine methyltransferase |
Scientific Background: | The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes. |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools