| Cat.No.: | EAb-3350 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 448-747 of human SIRT1 |
| Immunogen Sequence: | VALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 140kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC; IF; IP |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200; IP: 1:50 - 1:100 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | 293T,HeLa,Jurkat |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q96EB6; NP_036370.2; Gene ID 23411 |
| Alternative Name: | SIRT1; SIR2; SIR2L1; SIR2alpha; sirtuin 1 |
| Scientific Background: | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
| EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
| EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
| SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
| Related Gene / Proteins | |||
| Siah2 | SIK1 | SIMC1 | SIN3A |
| SIN3B | SIP1 | Sir2p | SIRT |
| SIRT1 | SIRT2 | SIRT3 | SIRT4 |
| SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.