NCOA1 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3344
Antibody Type:  Polyclonal
Immunogen:  Recombinant fusion protein containing a sequence corresponding to amino acids 1222-1441 of human NCOA1
Immunogen Sequence:  NPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  157kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IF
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  NIH/3T3,K-562
Species Reactivity:  Human, Mouse
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q15788; NP_003734.3; Gene ID 8648
Alternative Name:  NCOA1; F-SRC-1; KAT13A; RIP160; SRC1; bHLHe42; bHLHe74; nuclear receptor coactivator 1
Scientific Background:  The protein encoded by this gene acts as a transcriptional coactivator for steroid and nuclear hormone receptors. It is a member of the p160/steroid receptor coactivator (SRC) family and like other family members has histone acetyltransferase activity and contains a nuclear localization signal, as well as bHLH and PAS domains. The product of this gene binds nuclear receptors directly and stimulates the transcriptional activities in a hormone-dependent fashion. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Types
◆ Research Kits
EKIT-0046 HDAC3/NCOR1 fluorometric drug discovery Kit Inquiry
◆ Proteins & Enzymes
PE-0046 Recombinant Human NCOR1, GST-tagged Inquiry
◆ Antibodies
EAb-0065 NCOA1 Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0143 Recombinant Human NCOA1 293 Cell Lysate Inquiry
EL-0144 Recombinant Human NCOA2 293 Cell Lysate Inquiry
Related Gene / Proteins
NCAPD3 NCAPH2 NCOA1 NCOA2
NCOA3 NCoA4 NCOR1 ncor2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.