| Cat.No.: | EAb-3344 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1222-1441 of human NCOA1 |
| Immunogen Sequence: | NPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 157kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IF |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | NIH/3T3,K-562 |
| Species Reactivity: | Human, Mouse |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q15788; NP_003734.3; Gene ID 8648 |
| Alternative Name: | NCOA1; F-SRC-1; KAT13A; RIP160; SRC1; bHLHe42; bHLHe74; nuclear receptor coactivator 1 |
| Scientific Background: | The protein encoded by this gene acts as a transcriptional coactivator for steroid and nuclear hormone receptors. It is a member of the p160/steroid receptor coactivator (SRC) family and like other family members has histone acetyltransferase activity and contains a nuclear localization signal, as well as bHLH and PAS domains. The product of this gene binds nuclear receptors directly and stimulates the transcriptional activities in a hormone-dependent fashion. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Product Types | ||
| ◆ Research Kits | ||
| EKIT-0046 | HDAC3/NCOR1 fluorometric drug discovery Kit | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0046 | Recombinant Human NCOR1, GST-tagged | Inquiry |
| ◆ Antibodies | ||
| EAb-0065 | NCOA1 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0143 | Recombinant Human NCOA1 293 Cell Lysate | Inquiry |
| EL-0144 | Recombinant Human NCOA2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| NCAPD3 | NCAPH2 | NCOA1 | NCOA2 |
| NCOA3 | NCoA4 | NCOR1 | ncor2 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools