| Cat.No.: | EAb-3342 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human DNMT3A |
| Immunogen Sequence: | SVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLL |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 110kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IF |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | 293T,HeLa,HL-60,MCF7,HepG2,Mouse testis |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q9Y6K1; NP_715640.2; Gene ID 1788 |
| Alternative Name: | DNMT3A; DNMT3A2; M.HsaIIIA; TBRS; DNA methyltransferase 3 alpha |
| Scientific Background: | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0008 | Vinorelbine Tartrate | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0027 | Recombinant Human DNMT3A 293 Cell Lysate | Inquiry |
| EL-0028 | Recombinant Human DNMT3B 293 Cell Lysate | Inquiry |
| EL-0029 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| EL-0030 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| DNA alkyltransferase | DNAJC2 | DNAS1L1 | DNASE1L3 |
| DNMT | DNMT1 | DNMT2 | DNMT3A |
| DNMT3B | DNMT3L | DNMT4 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.