Cat.No.: | EAb-3342 |
Product Name: | DNMT3A Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human DNMT3A |
Immunogen Sequence: | SVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLL |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 110kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IF |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | 293T,HeLa,HL-60,MCF7,HepG2,Mouse testis |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot Q9Y6K1; NP_715640.2; Gene ID 1788 |
Alternative Name: | DNMT3A; DNMT3A2; M.HsaIIIA; TBRS; DNA methyltransferase 3 alpha |
Scientific Background: | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0008 | Vinorelbine Tartrate | Inquiry |
◆ Extracts & Lysates | ||
EL-0027 | Recombinant Human DNMT3A 293 Cell Lysate | Inquiry |
EL-0028 | Recombinant Human DNMT3B 293 Cell Lysate | Inquiry |
EL-0029 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
EL-0030 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
DNA alkyltransferase | DNAJC2 | DNAS1L1 | DNASE1L3 |
DNMT | DNMT1 | DNMT2 | DNMT3A |
DNMT3B | DNMT3L | DNMT4 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools