RNF2 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3332
Antibody Type:  Polyclonal
Immunogen:  Recombinant fusion protein containing a sequence corresponding to amino acids 1-336 of human RNF2
Immunogen Sequence:  MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  38kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IHC; IF; IP; ChIP
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000; IHC: 1:50 - 1:200; IP: 1:50 - 1:200; ChIP: 1:50 - 1:200
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  293T,Jurkat,U-937,Mouse brain,Mouse spleen
Species Reactivity:  Human, Mouse, Rat
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q99496; NP_009143.1; Gene ID 6045
Alternative Name:  RNF2; BAP-1; BAP1; DING; HIPI3; RING1B; RING2; ring finger protein 2
Scientific Background:  Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.