| Cat.No.: | EAb-3332 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-336 of human RNF2 |
| Immunogen Sequence: | MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 38kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC; IF; IP; ChIP |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200; IP: 1:50 - 1:200; ChIP: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | 293T,Jurkat,U-937,SH-SY5Y,Mouse brain,Mouse spleen |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q99496; NP_009143.1; Gene ID 6045 |
| Alternative Name: | RNF2; BAP-1; BAP1; DING; HIPI3; RING1B; RING2; ring finger protein 2 |
| Scientific Background: | Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0123 | Human RNF167 Knockout Cell Line | Inquiry |
| CL-0124 | Human RNF2 Knockout Cell Line 553bp insertion | Inquiry |
| CL-0125 | Human RNF25 Knockout Cell Line | Inquiry |
| CL-0126 | Human RNF26 Knockout Cell Line | Inquiry |
| CL-0127 | Human RNF24 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| RNA Helicase A | RNA pol II | RNF103 | RNF11 |
| RNF128 | RNF133 | RNF138 | RNF141 |
| RNF167 | RNF168 | RNF181 | RNF182 |
| RNF183 | RNF2 | RNF20 | RNF207 |
| RNF208 | RNF212 | RNF213 | RNF214 More > |
| RNF215 | RNF217 | RNF219 | RNF220 |
| RNF222 | RNF223 | RNF224 | RNF24 |
| RNF25 | RNF26 | RNF31 | RNF40 |
| RNF7 | RNF8 | RNP | RNPC3 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.