Cat.No.: | EAb-3312 |
Product Name: | KDM4A Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 825-1064 of human KDM4A |
Immunogen Sequence: | RFKLKCIFCKKRRKRTAGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSVASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 121kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IHC |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | NIH/3T3,Mouse spleen,Mouse brain,Mouse lung |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot O75164; NP_055478.2; Gene ID 9682 |
Alternative Name: | KDM4A; JHDM3A; JMJD2; JMJD2A; TDRD14A; lysine demethylase 4A |
Scientific Background: | This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor. |
Product Types | ||
◆ Cell Lines | ||
CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
KDM1 | KDM1A | KDM1B | KDM2 |
KDM2A | KDM2B | KDM3A | KDM3B |
KDM4 | KDM4A | KDM4B | KDM4C |
KDM4D | KDM4E | KDM5 | KDM5A |
KDM5B | KDM5C | KDM5D | KDM6A More > |
KDM6B | KDM6C | KDM7 | KDM7A |
KDM7B | KDM8 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools