| Cat.No.: | EAb-3305 |
| Product Name: | KDM2B Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human KDM2B. |
| Immunogen Sequence: | SGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSIN |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Species Reactivity: | Human |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q8NHM5; Gene ID 84678 |
| Alternative Name: | KDM2B; CXXC2; FBXL10; Fbl10; JHDM1B; PCCX2; lysine demethylase 2B |
| Scientific Background: | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
| CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
| CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
| CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| KDM1 | KDM1A | KDM1B | KDM2 |
| KDM2A | KDM2B | KDM3A | KDM3B |
| KDM4 | KDM4A | KDM4B | KDM4C |
| KDM4D | KDM4E | KDM5 | KDM5A |
| KDM5B | KDM5C | KDM5D | KDM6A More > |
| KDM6B | KDM6C | KDM7 | KDM7A |
| KDM7B | KDM8 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools