Cat.No.: | EAb-3304 |
Product Name: | MYST1 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human MYST1 |
Immunogen Sequence: | MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPED |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 58kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IF |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | OVCAR3,NIH/3T3 |
Species Reactivity: | Human, Mouse |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot Q9H7Z6; NP_892003.2; Gene ID 84148 |
Alternative Name: | KAT8; MOF; MYST1; ZC2HC8; hMOF; lysine acetyltransferase 8 |
Scientific Background: | This gene encodes a member of the MYST histone acetylase protein family. The encoded protein has a characteristic MYST domain containing an acetyl-CoA-binding site, a chromodomain typical of proteins which bind histones, and a C2HC-type zinc finger. Multiple transcript variants encoding different isoforms have been found for this gene. |
Product Types | ||
◆ Synthetic Peptides | ||
SP-0174 | Human KAT8 / MYST1 / MOF peptide | Inquiry |
◆ Antibodies | ||
EAb-0184 | MYCBP Polyclonal Antibody | Inquiry |
EAb-0204 | c-Myb Polyclonal Antibody | Inquiry |
EAb-0380 | MYSM1 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0344 | Human MYSM1 Knockout Cell Line 7bp deletion | Inquiry |
Related Gene / Proteins | |||
MYB | Myc | MYCBP | Myf-5 |
Myocilin | MyoD | MYSM1 | MYST1 |
MYST3 | Myt1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools