| Cat.No.: | EAb-3303 |
| Product Name: | PRDM2 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PRDM2 |
| Immunogen Sequence: | ILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAA |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 300kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | U-87MG,LO2,MCF7,Mouse brain,Mouse liver,Rat brain |
| Species Reactivity: | Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q13029; NP_036363.2; Gene ID 7799 |
| Alternative Name: | PRDM2; HUMHOXY1; KMT8; KMT8A; MTB-ZF; RIZ; RIZ1; RIZ2; PR/SET domain 2 |
| Scientific Background: | This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| BSM-0047 | SGC707 | Inquiry |
| ◆ Antibodies | ||
| EAb-0048 | PRMT6 Polyclonal Antibody | Inquiry |
| EAb-0049 | PRMT7 Polyclonal Antibody | Inquiry |
| EAb-0050 | PRMT1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| Pr-SET7 | PRC1 | PRC2 | PRDM1 |
| PRDM10 | PRDM11 | PRDM12 | PRDM13 |
| PRDM14 | PRDM15 | PRDM16 | PRDM17 |
| PRDM2 | PRDM3 | PRDM4 | PRDM5 |
| PRDM6 | PRDM7 | PRDM8 | PRDM9 More > |
| PREP1 | PRIM2 | PRKAA2 | PRKCA |
| PRKCB | PRKCE | PRKDC | PRKRIP1 |
| PRMT | prmt1 | PRMT2 | PRMT3 |
| PRMT5 | prmt6 | PRMT7 | PRMT8 |
| PRMT9 | Progerin | Protamine 2 | Prox1 |
| PRPF31 | PRPF40A | PRSS12 | PRSS55 |
| PRTFDC1 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
