IKK alpha Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3292
Product Name:  IKK alpha Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  Recombinant fusion protein containing a sequence corresponding to amino acids 516-745 of human IKK alpha
Immunogen Sequence:  EKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  110kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IF
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  Mouse brain,Rat brain
Species Reactivity:  Human, Mouse, Rat
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot O15111; NP_001269.3; Gene ID 1147
Alternative Name:  CHUK; IKBKA; IKK-alpha; IKK1; IKKA; NFKBIKA; TCF16; conserved helix-loop-helix ubiquitous kinase
Scientific Background:  This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor.
Product Types
◆ Cell Lines
CL-0052 Human IKBKG Knockout Cell Line 269bp insertion Inquiry
◆ Bioactive Small Molecules
BSM-0323 BMS 345541 (trifluoroacetate salt) Inquiry
◆ Antibodies
EAb-1951 IKKγ Monoclonal Antibody Inquiry
EAb-1952 IKKi/IKKε Polyclonal Antibody Inquiry
EAb-1953 IKKβ Monoclonal Antibody Inquiry
Related Gene / Proteins
Ikaros IKBKG IKK

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.