| Cat.No.: | EAb-3292 |
| Product Name: | IKK alpha Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 516-745 of human IKK alpha |
| Immunogen Sequence: | EKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 110kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IF |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | Mouse brain,Rat brain |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot O15111; NP_001269.3; Gene ID 1147 |
| Alternative Name: | CHUK; IKBKA; IKK-alpha; IKK1; IKKA; NFKBIKA; TCF16; conserved helix-loop-helix ubiquitous kinase |
| Scientific Background: | This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0052 | Human IKBKG Knockout Cell Line 269bp insertion | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0323 | BMS 345541 (trifluoroacetate salt) | Inquiry |
| ◆ Antibodies | ||
| EAb-1951 | IKKγ Monoclonal Antibody | Inquiry |
| EAb-1952 | IKKi/IKKε Polyclonal Antibody | Inquiry |
| EAb-1953 | IKKβ Monoclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| Ikaros | IKBKG | IKK | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
