Cat.No.: | EAb-3275 |
Product Name: | HAT1 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 245-419 of human HAT1 |
Immunogen Sequence: | TPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 50kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB; IHC; IF; ChIP |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200; ChIP: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | MCF7,SW480,Jurkat,293T,HeLa,HepG2,U-251MG,Mouse spleen,Rat testis |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot O14929; NP_003633.1; Gene ID 8520 |
Alternative Name: | HAT1; KAT1; histone acetyltransferase 1 |
Scientific Background: | The protein encoded by this gene is a type B histone acetyltransferase (HAT) that is involved in the rapid acetylation of newly synthesized cytoplasmic histones, which are in turn imported into the nucleus for de novo deposition onto nascent DNA chains. Histone acetylation, particularly of histone H4, plays an important role in replication-dependent chromatin assembly. Specifically, this HAT can acetylate soluble but not nucleosomal histone H4 at lysines 5 and 12, and to a lesser degree, histone H2A at lysine 5. Alternatively spliced transcript variants have been identified for this gene. |
Product Types | ||
◆ Antibodies | ||
EAb-0101 | HAT-3 Polyclonal Antibody | Inquiry |
EAb-0102 | HAT-2 Polyclonal Antibody | Inquiry |
◆ Research Kits | ||
EKIT-0142 | HAT (H4) Activity Fluorometric Assay Kit | Inquiry |
EKIT-0143 | HAT Activity Colorimetric Assay Kit | Inquiry |
EKIT-0144 | HAT Activity Fluorometric Assay Kit | Inquiry |
Related Gene / Proteins | |||
HAGE | Haspin | HAT | HAT1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools