| Cat.No.: | EAb-3268 |
| Product Name: | CARM1 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 409-608 of human CARM1 |
| Immunogen Sequence: | TEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 75kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:200 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | 22Rv1,A-431,Mouse spleen,Rat brain |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q86X55; NP_954592.1; Gene ID 10498 |
| Alternative Name: | CARM1; PRMT4; histone-arginine methyltransferase CARM1 |
| Scientific Background: | This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9. |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0008 | PRMT4 peptide substrate, Biotin-labeled | Inquiry |
| ◆ Cell Lines | ||
| CL-0050 | Human CARM1 Knockout Cell Line 8bp deletion | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0123 | Ellagic acid | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0134 | Recombinant Human CARM1 293 Cell Lysate | Inquiry |
| EL-0148 | Recombinant Human CAMTA2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| CABIN1 | CAF1 | CAMKIV | CAMTA2 |
| CAPNS2 | CARHSP1 | CARM1 | CASC3 |
| CASP | CASP1 | CASP3 | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools