CREBBP Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3263
Product Name:  CREBBP Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CREBBP
Immunogen Sequence:  GGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQ
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  280kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IHC
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000; IHC: 1:50 - 1:200
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Positive Control:  U-87MG,HeLa
Species Reactivity:  Human, Mouse, Rat
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q92793; NP_004371.2; Gene ID 1387
Alternative Name:  CREBBP; CBP; KAT3A; RSTS; RSTS1; CREB-binding protein
Scientific Background:  This gene is ubiquitously expressed and is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. The protein encoded by this gene has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex. This protein acetylates both histone and non-histone proteins. This protein shares regions of very high sequence similarity with protein p300 in its bromodomain, cysteine-histidine-rich regions, and histone acetyltransferase domain. Mutations in this gene cause Rubinstein-Taybi syndrome (RTS). Chromosomal translocations involving this gene have been associated with acute myeloid leukemia. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Types
◆ Cell Lines
CL-0055 Human CREBBP Knockout Cell Line 1bp insertion Inquiry
◆ Bioactive Small Molecules
BSM-0094 C646 Inquiry
BSM-0124 EML-425 Inquiry
BSM-0150 I-CBP112 (Hydrochloride) Inquiry
◆ Research Kits
EKIT-0122 CBP bromodomain TR-FRET Assay Kit Inquiry
Related Gene / Proteins
CREB CREB3 crebbp CRISP1
CRISP3 CRP

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.