| Cat.No.: | EAb-3263 |
| Product Name: | CREBBP Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CREBBP |
| Immunogen Sequence: | GGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQ |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 280kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | U-87MG,HeLa |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q92793; NP_004371.2; Gene ID 1387 |
| Alternative Name: | CREBBP; CBP; KAT3A; RSTS; RSTS1; CREB-binding protein |
| Scientific Background: | This gene is ubiquitously expressed and is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. The protein encoded by this gene has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex. This protein acetylates both histone and non-histone proteins. This protein shares regions of very high sequence similarity with protein p300 in its bromodomain, cysteine-histidine-rich regions, and histone acetyltransferase domain. Mutations in this gene cause Rubinstein-Taybi syndrome (RTS). Chromosomal translocations involving this gene have been associated with acute myeloid leukemia. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0055 | Human CREBBP Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0094 | C646 | Inquiry |
| BSM-0124 | EML-425 | Inquiry |
| BSM-0150 | I-CBP112 (Hydrochloride) | Inquiry |
| ◆ Research Kits | ||
| EKIT-0122 | CBP bromodomain TR-FRET Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| CREB | CREB3 | crebbp | CRISP1 |
| CRISP3 | CRP | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools